PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1363s0020.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 351aa    MW: 38802 Da    PI: 9.1987
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1363s0020.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.87.2e-56271541128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL++k+++ ++++ ++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tg
  SapurV1A.1363s0020.4.p  27 LPPGFRFHPTDEELITHYLQNKISDADFSC-RAIGDVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTG 112
                             79****************************.89***************99999********************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kdke++++ + +l+g+kktLvfy+grap+gekt+Wvmheyr+
  SapurV1A.1363s0020.4.p 113 KDKEIFNSvTLQLIGMKKTLVFYRGRAPRGEKTNWVMHEYRV 154
                             ******9878889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6424175IPR003441NAC domain
PROSITE profilePS5100560.19727175IPR003441NAC domain
PfamPF023653.2E-2928154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MKPTGDKGKK QVEKEKEMEG DAKEETLPPG FRFHPTDEEL ITHYLQNKIS DADFSCRAIG  60
DVDLNKCEPW DLPGKAKMGE KEWYFFSLRD RKYPTGVRTN RATNTGYWKT TGKDKEIFNS  120
VTLQLIGMKK TLVFYRGRAP RGEKTNWVMH EYRVHAKAAF RASKDEWVVC RIFQKSAGPK  180
KYPPNQSRTG NPFYNLEIGP SVMPPQMMQA AADNFQLPIG RNYMMSNAEL QAELTRVFRA  240
GGSAGINLPM QSPLNNSYSV GGGGGGGGGC FTVSGLNLNL GGATSQPVMR PMPPPAMNQQ  300
DATPSMMASA GSFAVEQAGY GAEMNGANGH SNRFMGMQQC MDLENYWPPY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-562618116171NAC domain-containing protein 19
4dul_A2e-562618116171NAC domain-containing protein 19
1ut7_B2e-562618116171NO APICAL MERISTEM PROTEIN
1ut7_A2e-562618116171NO APICAL MERISTEM PROTEIN
1ut4_B2e-562618116171NO APICAL MERISTEM PROTEIN
1ut4_A2e-562618116171NO APICAL MERISTEM PROTEIN
3swp_D3e-562618119174NAC domain-containing protein 19
3swp_C3e-562618119174NAC domain-containing protein 19
3swp_B3e-562618119174NAC domain-containing protein 19
3swp_A3e-562618119174NAC domain-containing protein 19
3swm_D3e-562618119174NAC domain-containing protein 19
3swm_C3e-562618119174NAC domain-containing protein 19
3swm_B3e-562618119174NAC domain-containing protein 19
3swm_A3e-562618119174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045043.10.0PREDICTED: NAC domain-containing protein 100-like isoform X3
TrEMBLU5FFA70.0U5FFA7_POPTR; Uncharacterized protein
STRINGPOPTR_0018s03910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-115NAC domain containing protein 38